PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre16.g675100.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family CO-like
Protein Properties Length: 1164aa    MW: 119252 Da    PI: 5.1672
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre16.g675100.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.11.1e-053766535
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHk 35
                         C+ + +  ++ +Ce++++llC++C +  H 
  Cre16.g675100.t1.1 37 QCTWCLSP-AITYCESDKVLLCKSCDVRLHT 66
                        69999988.*****************99995 PP

2CCT54.54.3e-1910971140144
                 CCT    1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44  
                          Re+++ R++eKrk+R+F+K irY++RK +Ae RpR++GrF++++
  Cre16.g675100.t1.1 1097 REERVARFREKRKRRNFDKVIRYATRKYYAEVRPRIRGRFARRE 1140
                          9****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062036.0E-1410971139IPR010402CCT domain
PROSITE profilePS5101715.75510971139IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1164 aa     Download sequence    Send to blast
MTPTCCVLAP AGAFPAGTAV TTAHLGSSSP AAAHSGQCTW CLSPAITYCE SDKVLLCKSC  60
DVRLHTSGLV ASRHLRRIPC QSCFGRGAAL RCRDCARGYY CEQCHDAIVA AVPTPGVCDP  120
KDSRGLPPAH QTTPVGLLAP LPALPQDLLS DDPFMADALT CADVAAAAAG GPVAAHCRDD  180
EEEEEDGGCT AAAAAAHSAS GFAHAPSSSG GAGSTPASSV TVAVVARQRP AAPRVAGKWR  240
GGISVTAAVL AAAAAAAATA AAADEEAAGS EEEPETPEEN EPEAEARVED EGQEAGEDAE  300
MEDCAAAVPA AAAAGATTTA CAMAEAAAGT GAAGDGHDPQ QVEILVPLCR VPSSSAGGGG  360
LCAACRGGVP PFDAEEAEPH EIGVAAVERE AVGGGKDGSS GGCQWQQGGM AACPRTACLV  420
CAAALPARCR RALSSMGSDD YDDAEMEQCD VAIEKEEEEA LAAAAASAGG RRGGAGASSA  480
PAAGVGVRLV PVWGHAKAAV VAGRELERGT AAACACFGKW CGYVSALRDG QLTSIGHAAL  540
QHRHEAAEAA GGAVTEPTEA DAGVGFEAEA FSRQGSFSTS MQEAQQALQL QELLEDDHTP  600
PPPAAGPYER QFPSLAGAVQ QLPQHDQALP LAVAMAPPAP PLAAVAPAAE AAGAEAGVEA  660
GDAEDMFAGM AGLSEQEQRR MLLQQLEELR QQEQARLQHM HWLQQQQQQQ QALHMHHQVH  720
MQQVHMQLMA CTPHAQQLHP QPQEPVQQPT QPAAHATDMD MNIDGTRHGG SASLTPPAPW  780
AHVQMIPQQA PMPAPPQQQS QPFGILPMQQ GQPPYPVQLY QQHLAEQYEA PFSYTAEAGI  840
CRPEVPPLPP QQQQPPQAQL QQQQQVPFTR RMSEADSTSP FASSAIAGVP ATPSTPSDAA  900
PPAPPAPATM AAAAAAAAAA AAPPAKPPAP GVPAARAAVQ PPPQGSLLHR GPSLNGGIRK  960
PPPPPVITVI KRGPDGSILH KCSAPPPAVR RSVNGKRDDV PAAAGARAAA PVVAVDTKAT  1020
EAAANTSAAA VPTSAFSTTR AAVAAVAPGV AAQQQRNTPA YAPITTPQAT AYAAQVLAAA  1080
AAAAAGSGAS GVRELTREER VARFREKRKR RNFDKVIRYA TRKYYAEVRP RIRGRFARRE  1140
EIEAWKMAHG GPDVEVPAVL DDD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre16.g675100.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001695832.10.0hypothetical protein CHLREDRAFT_149159, partial
TrEMBLA8J3K60.0A8J3K6_CHLRE; Predicted protein (Fragment)
STRINGEDP011690.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP6111112
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.18e-12B-box type zinc finger protein with CCT domain